PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g056570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 539aa    MW: 60013.4 Da    PI: 5.8313
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g056570.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS449.72e-1371705383374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                      +L+ecA av+s dlel+++l+++l++++s +g+p+qRl ay++e+L arla+s+s++ykal++++ +     e l+++++++e++P++kf++  
  Csa03g056570.1 170 GVLYECAMAVESYDLELTDWLISQLQQMVSVSGEPVQRLGAYMLEGLVARLASSGSSIYKALRCKDPT---GPELLTYMHILYEACPYFKFGYES 261
                     689****************************************************************9...9*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aI eav++e+ vHiiDf+isqG+QW++L++aL +Rp+gpp++RiTg+++p+s+  ++  le +g+rL k+Ae +gvpfef+  +a  ++++e
  Csa03g056570.1 262 ANGAIAEAVKNESFVHIIDFQISQGGQWVSLIRALGARPGGPPKVRITGIDDPRSSfaRQGGLELVGQRLGKLAEMCGVPFEFHG-AALCCTEVE 355
                     *****************************************************999999**************************.899****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +e+L v++gEalaVn+ l lh+++desv++e++rd++L+lvk+lsP+vv++veqea++n+++Fl rf+e++++y a+f+s+++kl+r+++eri+v
  Csa03g056570.1 356 IEKLGVRNGEALAVNFPLVLHHMPDESVTVENHRDRLLRLVKRLSPNVVTLVEQEANTNTSPFLPRFVETMNHYLAVFESIDVKLARDHKERINV 450
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E+++l+re+vn++aceg er+erhe l+kWr+r+++aGFkp+pls+++++++k ll+ ++++ y++ee++g+l+lgWk++pL++ +aWr
  Csa03g056570.1 451 EQHCLAREVVNLIACEGVEREERHEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEK-YTLEERDGALYLGWKNQPLITSCAWR 538
                     ************************************************************65.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.702142519IPR005202Transcription factor GRAS
PfamPF035146.7E-135170538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MEATQKHMIQ DGSSMFYHPP SSVKQMDLSV QTFDSYCTLE SSSGTKSHPC LNMNNNNNNS  60
SSTTSFSSNE SPISQANNNN NNNNNNNNNN SSRFTHSPED NNNSPLSGSS ATNNNETELS  120
LMLKDLETAM MEPDLDNSFN HQGGFGQQHR AVSSAMYRSM EMISRGDLKG VLYECAMAVE  180
SYDLELTDWL ISQLQQMVSV SGEPVQRLGA YMLEGLVARL ASSGSSIYKA LRCKDPTGPE  240
LLTYMHILYE ACPYFKFGYE SANGAIAEAV KNESFVHIID FQISQGGQWV SLIRALGARP  300
GGPPKVRITG IDDPRSSFAR QGGLELVGQR LGKLAEMCGV PFEFHGAALC CTEVEIEKLG  360
VRNGEALAVN FPLVLHHMPD ESVTVENHRD RLLRLVKRLS PNVVTLVEQE ANTNTSPFLP  420
RFVETMNHYL AVFESIDVKL ARDHKERINV EQHCLAREVV NLIACEGVER EERHEPLGKW  480
RSRFHMAGFK PYPLSSYVNA TIKGLLESYS EKYTLEERDG ALYLGWKNQP LITSCAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-6019153826375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0125610.0AC012561.2 Arabidopsis thaliana chromosome I BAC F11F12 genomic sequence, complete sequence.
GenBankAC0792790.0AC079279.4 Arabidopsis thaliana chromosome 1 BAC F17J6 genomic sequence, complete sequence.
GenBankAY0349290.0AY034929.1 Arabidopsis thaliana putative scarecrow protein (At1g50600) mRNA, partial cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010500634.10.0PREDICTED: scarecrow-like protein 5
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLR0IEZ40.0R0IEZ4_9BRAS; Uncharacterized protein
STRINGAT1G50600.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5